Placeholder image of a protein
Icon representing a puzzle

1114: Unsolved De-novo Freestyle 53: Predicted Contacts

Closed since over 10 years ago

Intermediate Overall Prediction Predicted Contacts

Summary

Created
July 15, 2015
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1111, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1111 and use them as a starting point here.



Sequence:

MPGFTAPTRRQVLSLYKEFIKNANQFNNYNFREYFLSKTRTTFRKNMNQQDPKVLMNLFKEAKNDLGVLKRQSVISQMYTFDRLVVEPLQGRKH

Top groups

  1. Avatar for CHNO Junkies 21. CHNO Junkies 1 pt. 0
  2. Avatar for Window Group 22. Window Group 1 pt. 0
  1. Avatar for Close At Hand 221. Close At Hand Lv 1 1 pt. 5,230
  2. Avatar for atin 222. atin Lv 1 1 pt. 5,212
  3. Avatar for DrNoodles 223. DrNoodles Lv 1 1 pt. 5,169
  4. Avatar for aminaman 224. aminaman Lv 1 1 pt. 5,146
  5. Avatar for AruBunny 225. AruBunny Lv 1 1 pt. 4,957
  6. Avatar for brucederby 226. brucederby Lv 1 1 pt. 4,885
  7. Avatar for HG2093 227. HG2093 Lv 1 1 pt. 4,534
  8. Avatar for Rabies4U 228. Rabies4U Lv 1 1 pt. 4,534
  9. Avatar for emaitsch 229. emaitsch Lv 1 1 pt. 3,790
  10. Avatar for Jack.isaksson 230. Jack.isaksson Lv 1 1 pt. 3,647

Comments