Placeholder image of a protein
Icon representing a puzzle

1114: Unsolved De-novo Freestyle 53: Predicted Contacts

Closed since over 10 years ago

Intermediate Overall Prediction Predicted Contacts

Summary

Created
July 15, 2015
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1111, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1111 and use them as a starting point here.



Sequence:

MPGFTAPTRRQVLSLYKEFIKNANQFNNYNFREYFLSKTRTTFRKNMNQQDPKVLMNLFKEAKNDLGVLKRQSVISQMYTFDRLVVEPLQGRKH

Top groups

  1. Avatar for CHNO Junkies 21. CHNO Junkies 1 pt. 0
  2. Avatar for Window Group 22. Window Group 1 pt. 0
  1. Avatar for KarenCH 41. KarenCH Lv 1 42 pts. 10,420
  2. Avatar for gloverd 42. gloverd Lv 1 41 pts. 10,409
  3. Avatar for joremen 43. joremen Lv 1 40 pts. 10,345
  4. Avatar for Sissue 44. Sissue Lv 1 39 pts. 10,338
  5. Avatar for jobo0502 45. jobo0502 Lv 1 38 pts. 10,332
  6. Avatar for O Seki To 46. O Seki To Lv 1 38 pts. 10,327
  7. Avatar for LociOiling 47. LociOiling Lv 1 37 pts. 10,318
  8. Avatar for cbwest 48. cbwest Lv 1 36 pts. 10,305
  9. Avatar for Giant Berk 49. Giant Berk Lv 1 35 pts. 10,286
  10. Avatar for andrewxc 50. andrewxc Lv 1 34 pts. 10,264

Comments