Placeholder image of a protein
Icon representing a puzzle

1114: Unsolved De-novo Freestyle 53: Predicted Contacts

Closed since over 10 years ago

Intermediate Overall Prediction Predicted Contacts

Summary


Created
July 15, 2015
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1111, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1111 and use them as a starting point here.



Sequence:

MPGFTAPTRRQVLSLYKEFIKNANQFNNYNFREYFLSKTRTTFRKNMNQQDPKVLMNLFKEAKNDLGVLKRQSVISQMYTFDRLVVEPLQGRKH

Top groups


  1. Avatar for CHNO Junkies 21. CHNO Junkies 1 pt. 0
  2. Avatar for Window Group 22. Window Group 1 pt. 0

  1. Avatar for weitzen 61. weitzen Lv 1 26 pts. 10,168
  2. Avatar for FarzadBekran 62. FarzadBekran Lv 1 25 pts. 10,157
  3. Avatar for pmdpmd 63. pmdpmd Lv 1 25 pts. 10,147
  4. Avatar for jamiexq 64. jamiexq Lv 1 24 pts. 10,145
  5. Avatar for joaniegirl 65. joaniegirl Lv 1 23 pts. 10,141
  6. Avatar for fishercat 66. fishercat Lv 1 23 pts. 10,139
  7. Avatar for heather-1 67. heather-1 Lv 1 22 pts. 10,128
  8. Avatar for jermainiac 68. jermainiac Lv 1 22 pts. 10,126
  9. Avatar for silverberg 69. silverberg Lv 1 21 pts. 10,102
  10. Avatar for Skippysk8s 70. Skippysk8s Lv 1 20 pts. 10,076

Comments