Placeholder image of a protein
Icon representing a puzzle

1114: Unsolved De-novo Freestyle 53: Predicted Contacts

Closed since over 10 years ago

Intermediate Overall Prediction Predicted Contacts

Summary


Created
July 15, 2015
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1111, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1111 and use them as a starting point here.



Sequence:

MPGFTAPTRRQVLSLYKEFIKNANQFNNYNFREYFLSKTRTTFRKNMNQQDPKVLMNLFKEAKNDLGVLKRQSVISQMYTFDRLVVEPLQGRKH

Top groups


  1. Avatar for CHNO Junkies 21. CHNO Junkies 1 pt. 0
  2. Avatar for Window Group 22. Window Group 1 pt. 0

  1. Avatar for YeshuaLives 71. YeshuaLives Lv 1 20 pts. 10,069
  2. Avatar for fryguy 72. fryguy Lv 1 19 pts. 10,064
  3. Avatar for shettler 73. shettler Lv 1 19 pts. 10,052
  4. Avatar for actiasluna 74. actiasluna Lv 1 18 pts. 10,045
  5. Avatar for gurra66 75. gurra66 Lv 1 18 pts. 10,038
  6. Avatar for TomTaylor 76. TomTaylor Lv 1 17 pts. 10,038
  7. Avatar for uhuuhu 77. uhuuhu Lv 1 17 pts. 10,015
  8. Avatar for Iron pet 78. Iron pet Lv 1 16 pts. 10,004
  9. Avatar for ecali 79. ecali Lv 1 16 pts. 10,003
  10. Avatar for Bletchley Park 80. Bletchley Park Lv 1 15 pts. 9,996

Comments