Placeholder image of a protein
Icon representing a puzzle

1114: Unsolved De-novo Freestyle 53: Predicted Contacts

Closed since over 10 years ago

Intermediate Overall Prediction Predicted Contacts

Summary

Created
July 15, 2015
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1111, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1111 and use them as a starting point here.



Sequence:

MPGFTAPTRRQVLSLYKEFIKNANQFNNYNFREYFLSKTRTTFRKNMNQQDPKVLMNLFKEAKNDLGVLKRQSVISQMYTFDRLVVEPLQGRKH

Top groups

  1. Avatar for CHNO Junkies 21. CHNO Junkies 1 pt. 0
  2. Avatar for Window Group 22. Window Group 1 pt. 0
  1. Avatar for isaksson 81. isaksson Lv 1 15 pts. 9,995
  2. Avatar for Colostomy EXPLOSION. 82. Colostomy EXPLOSION. Lv 1 15 pts. 9,984
  3. Avatar for Pro Lapser 83. Pro Lapser Lv 1 14 pts. 9,980
  4. Avatar for Soggy Doglog 84. Soggy Doglog Lv 1 14 pts. 9,973
  5. Avatar for molleke 85. molleke Lv 1 13 pts. 9,966
  6. Avatar for alwen 86. alwen Lv 1 13 pts. 9,955
  7. Avatar for Amphimixus 87. Amphimixus Lv 1 13 pts. 9,952
  8. Avatar for rinze 88. rinze Lv 1 12 pts. 9,928
  9. Avatar for Festering Wounds 89. Festering Wounds Lv 1 12 pts. 9,924
  10. Avatar for Steven Pletsch 90. Steven Pletsch Lv 1 12 pts. 9,912

Comments