1114: Unsolved De-novo Freestyle 53: Predicted Contacts
Closed since over 10 years ago
Intermediate Overall Prediction Predicted ContactsSummary
- Created
- July 15, 2015
- Expires
- Max points
- 100
This is a follow-up puzzle for Puzzle 1111, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1111 and use them as a starting point here.
Sequence:
MPGFTAPTRRQVLSLYKEFIKNANQFNNYNFREYFLSKTRTTFRKNMNQQDPKVLMNLFKEAKNDLGVLKRQSVISQMYTFDRLVVEPLQGRKH
Top groups
-
100 pts. 11,503
-
-
-
-
-
-
-
-
-