Placeholder image of a protein
Icon representing a puzzle

1116: Revisiting Puzzle 83: Cardiotoxin

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
July 21, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 4 pts. 8,823
  2. Avatar for Russian team 12. Russian team 2 pts. 8,609
  3. Avatar for It's over 9000! 13. It's over 9000! 2 pts. 8,539
  4. Avatar for xkcd 14. xkcd 1 pt. 8,521
  5. Avatar for Natural Abilities 15. Natural Abilities 1 pt. 8,493
  6. Avatar for CHNO Junkies 16. CHNO Junkies 1 pt. 7,898
  7. Avatar for FoldIt@Netherlands 17. FoldIt@Netherlands 1 pt. 7,827
  8. Avatar for Minions of TWIS 18. Minions of TWIS 1 pt. 7,550
  9. Avatar for CureCoin 19. CureCoin 1 pt. 7,198
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 6,652
  1. Avatar for nicobul 31. nicobul Lv 1 53 pts. 9,090
  2. Avatar for Skippysk8s 32. Skippysk8s Lv 1 52 pts. 9,080
  3. Avatar for mimi 33. mimi Lv 1 51 pts. 9,059
  4. Avatar for Blipperman 34. Blipperman Lv 1 50 pts. 9,058
  5. Avatar for dcrwheeler 35. dcrwheeler Lv 1 49 pts. 9,057
  6. Avatar for g_b 36. g_b Lv 1 48 pts. 9,045
  7. Avatar for uhuuhu 37. uhuuhu Lv 1 46 pts. 9,033
  8. Avatar for jamiexq 38. jamiexq Lv 1 45 pts. 9,012
  9. Avatar for christioanchauvin 39. christioanchauvin Lv 1 44 pts. 9,010
  10. Avatar for gurra66 40. gurra66 Lv 1 43 pts. 8,998

Comments