Placeholder image of a protein
Icon representing a puzzle

1116: Revisiting Puzzle 83: Cardiotoxin

Closed since over 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
July 21, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Top groups


  1. Avatar for freefolder 21. freefolder 1 pt. 6,528

  1. Avatar for reefyrob
    1. reefyrob Lv 1
    100 pts. 9,450
  2. Avatar for bertro 2. bertro Lv 1 99 pts. 9,416
  3. Avatar for Deleted player 3. Deleted player pts. 9,401
  4. Avatar for johnmitch 4. johnmitch Lv 1 95 pts. 9,322
  5. Avatar for mirp 5. mirp Lv 1 93 pts. 9,310
  6. Avatar for KarenCH 6. KarenCH Lv 1 91 pts. 9,309
  7. Avatar for retiredmichael 7. retiredmichael Lv 1 89 pts. 9,278
  8. Avatar for dembones 8. dembones Lv 1 87 pts. 9,275
  9. Avatar for frood66 9. frood66 Lv 1 85 pts. 9,265
  10. Avatar for smilingone 10. smilingone Lv 1 84 pts. 9,263

Comments