Placeholder image of a protein
Icon representing a puzzle

1116: Revisiting Puzzle 83: Cardiotoxin

Closed since over 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
July 21, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Top groups


  1. Avatar for Beta Folders 100 pts. 9,494
  2. Avatar for Go Science 2. Go Science 78 pts. 9,312
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 60 pts. 9,310
  4. Avatar for Contenders 4. Contenders 45 pts. 9,275
  5. Avatar for Gargleblasters 5. Gargleblasters 33 pts. 9,265
  6. Avatar for Deleted group 6. Deleted group pts. 9,209
  7. Avatar for Void Crushers 7. Void Crushers 17 pts. 9,196
  8. Avatar for HMT heritage 8. HMT heritage 12 pts. 9,169
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 8 pts. 9,166
  10. Avatar for Deleted group 10. Deleted group pts. 8,865

  1. Avatar for Colostomy EXPLOSION. 91. Colostomy EXPLOSION. Lv 1 11 pts. 8,483
  2. Avatar for PrettyPony2001 92. PrettyPony2001 Lv 1 11 pts. 8,481
  3. Avatar for Giant Berk 93. Giant Berk Lv 1 11 pts. 8,458
  4. Avatar for Mydogisa Toelicker 94. Mydogisa Toelicker Lv 1 10 pts. 8,445
  5. Avatar for nemo7731 95. nemo7731 Lv 1 10 pts. 8,437
  6. Avatar for Flagg65a 96. Flagg65a Lv 1 10 pts. 8,433
  7. Avatar for dahast.de 97. dahast.de Lv 1 9 pts. 8,428
  8. Avatar for Pro Lapser 98. Pro Lapser Lv 1 9 pts. 8,404
  9. Avatar for Mohambone 99. Mohambone Lv 1 9 pts. 8,393
  10. Avatar for RockOn 100. RockOn Lv 1 9 pts. 8,384

Comments