Placeholder image of a protein
Icon representing a puzzle

1116: Revisiting Puzzle 83: Cardiotoxin

Closed since over 10 years ago

Intermediate Intermediate Intermediate Overall Overall Overall Prediction Prediction Prediction

Summary


Created
July 21, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Top groups


  1. Avatar for Beta Folders 100 pts. 9,494
  2. Avatar for Go Science 2. Go Science 78 pts. 9,312
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 60 pts. 9,310
  4. Avatar for Contenders 4. Contenders 45 pts. 9,275
  5. Avatar for Gargleblasters 5. Gargleblasters 33 pts. 9,265
  6. Avatar for Deleted group 6. Deleted group pts. 9,209
  7. Avatar for Void Crushers 7. Void Crushers 17 pts. 9,196
  8. Avatar for HMT heritage 8. HMT heritage 12 pts. 9,169
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 8 pts. 9,166
  10. Avatar for Deleted group 10. Deleted group pts. 8,865

  1. Avatar for dbuske 121. dbuske Lv 1 4 pts. 8,119
  2. Avatar for harvardman 122. harvardman Lv 1 4 pts. 8,103
  3. Avatar for arginia 123. arginia Lv 1 4 pts. 8,061
  4. Avatar for JUMELLE54 124. JUMELLE54 Lv 1 4 pts. 8,024
  5. Avatar for Eric Detheridge 125. Eric Detheridge Lv 1 4 pts. 8,022
  6. Avatar for pfeiffelfloyd 126. pfeiffelfloyd Lv 1 4 pts. 8,017
  7. Avatar for AryehK 127. AryehK Lv 1 4 pts. 8,013
  8. Avatar for DScott 128. DScott Lv 1 3 pts. 8,009
  9. Avatar for davidgn 129. davidgn Lv 1 3 pts. 8,007
  10. Avatar for lamoille 130. lamoille Lv 1 3 pts. 7,999

Comments