Placeholder image of a protein
Icon representing a puzzle

1116: Revisiting Puzzle 83: Cardiotoxin

Closed since over 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
July 21, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Top groups


  1. Avatar for Beta Folders 100 pts. 9,494
  2. Avatar for Go Science 2. Go Science 78 pts. 9,312
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 60 pts. 9,310
  4. Avatar for Contenders 4. Contenders 45 pts. 9,275
  5. Avatar for Gargleblasters 5. Gargleblasters 33 pts. 9,265
  6. Avatar for Deleted group 6. Deleted group pts. 9,209
  7. Avatar for Void Crushers 7. Void Crushers 17 pts. 9,196
  8. Avatar for HMT heritage 8. HMT heritage 12 pts. 9,169
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 8 pts. 9,166
  10. Avatar for Deleted group 10. Deleted group pts. 8,865

  1. Avatar for ViJay7019 151. ViJay7019 Lv 1 2 pts. 7,704
  2. Avatar for IHGreenman 152. IHGreenman Lv 1 1 pt. 7,702
  3. Avatar for tela 153. tela Lv 1 1 pt. 7,665
  4. Avatar for Iron pet 154. Iron pet Lv 1 1 pt. 7,630
  5. Avatar for proteansoup 155. proteansoup Lv 1 1 pt. 7,621
  6. Avatar for Thebatman012 156. Thebatman012 Lv 1 1 pt. 7,616
  7. Avatar for Thinlizard 157. Thinlizard Lv 1 1 pt. 7,604
  8. Avatar for lange 158. lange Lv 1 1 pt. 7,602
  9. Avatar for Ellis Shih 159. Ellis Shih Lv 1 1 pt. 7,599
  10. Avatar for gldisater 160. gldisater Lv 1 1 pt. 7,550

Comments