Placeholder image of a protein
Icon representing a puzzle

1116: Revisiting Puzzle 83: Cardiotoxin

Closed since over 10 years ago

Intermediate Intermediate Intermediate Overall Overall Overall Prediction Prediction Prediction

Summary


Created
July 21, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Top groups


  1. Avatar for Beta Folders 100 pts. 9,494
  2. Avatar for Go Science 2. Go Science 78 pts. 9,312
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 60 pts. 9,310
  4. Avatar for Contenders 4. Contenders 45 pts. 9,275
  5. Avatar for Gargleblasters 5. Gargleblasters 33 pts. 9,265
  6. Avatar for Deleted group 6. Deleted group pts. 9,209
  7. Avatar for Void Crushers 7. Void Crushers 17 pts. 9,196
  8. Avatar for HMT heritage 8. HMT heritage 12 pts. 9,169
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 8 pts. 9,166
  10. Avatar for Deleted group 10. Deleted group pts. 8,865

  1. Avatar for ivalnic 191. ivalnic Lv 1 1 pt. 7,179
  2. Avatar for cor2020 192. cor2020 Lv 1 1 pt. 7,171
  3. Avatar for Close At Hand 193. Close At Hand Lv 1 1 pt. 7,161
  4. Avatar for Inkedhands 194. Inkedhands Lv 1 1 pt. 7,157
  5. Avatar for gilofean 195. gilofean Lv 1 1 pt. 7,157
  6. Avatar for t012 196. t012 Lv 1 1 pt. 7,132
  7. Avatar for Firestorm4141 197. Firestorm4141 Lv 1 1 pt. 7,129
  8. Avatar for DemigodLuo 198. DemigodLuo Lv 1 1 pt. 7,128
  9. Avatar for Cruxon_Noctus 199. Cruxon_Noctus Lv 1 1 pt. 7,117
  10. Avatar for karost 200. karost Lv 1 1 pt. 7,111

Comments