Placeholder image of a protein
Icon representing a puzzle

1116: Revisiting Puzzle 83: Cardiotoxin

Closed since over 10 years ago

Intermediate Intermediate Intermediate Overall Overall Overall Prediction Prediction Prediction

Summary


Created
July 21, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Top groups


  1. Avatar for Beta Folders 100 pts. 9,494
  2. Avatar for Go Science 2. Go Science 78 pts. 9,312
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 60 pts. 9,310
  4. Avatar for Contenders 4. Contenders 45 pts. 9,275
  5. Avatar for Gargleblasters 5. Gargleblasters 33 pts. 9,265
  6. Avatar for Deleted group 6. Deleted group pts. 9,209
  7. Avatar for Void Crushers 7. Void Crushers 17 pts. 9,196
  8. Avatar for HMT heritage 8. HMT heritage 12 pts. 9,169
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 8 pts. 9,166
  10. Avatar for Deleted group 10. Deleted group pts. 8,865

  1. Avatar for jencimons 201. jencimons Lv 1 1 pt. 7,111
  2. Avatar for wingsandstache 202. wingsandstache Lv 1 1 pt. 7,078
  3. Avatar for mistral71 203. mistral71 Lv 1 1 pt. 7,051
  4. Avatar for GreekCivilization 204. GreekCivilization Lv 1 1 pt. 7,045
  5. Avatar for mirjamvandelft 205. mirjamvandelft Lv 1 1 pt. 7,044
  6. Avatar for Tsskyx 207. Tsskyx Lv 1 1 pt. 7,033
  7. Avatar for Andi1960 208. Andi1960 Lv 1 1 pt. 7,013
  8. Avatar for Bosley180 209. Bosley180 Lv 1 1 pt. 6,987
  9. Avatar for may of rose 210. may of rose Lv 1 1 pt. 6,980

Comments