Placeholder image of a protein
Icon representing a puzzle

1116: Revisiting Puzzle 83: Cardiotoxin

Closed since almost 11 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
July 21, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Top groups


  1. Avatar for Beta Folders 100 pts. 9,494
  2. Avatar for Go Science 2. Go Science 78 pts. 9,312
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 60 pts. 9,310
  4. Avatar for Contenders 4. Contenders 45 pts. 9,275
  5. Avatar for Gargleblasters 5. Gargleblasters 33 pts. 9,265
  6. Avatar for Deleted group 6. Deleted group pts. 9,209
  7. Avatar for Void Crushers 7. Void Crushers 17 pts. 9,196
  8. Avatar for HMT heritage 8. HMT heritage 12 pts. 9,169
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 8 pts. 9,166
  10. Avatar for Deleted group 10. Deleted group pts. 8,865

  1. Avatar for Gradengk 241. Gradengk Lv 1 1 pt. 2,439
  2. Avatar for GDani07 242. GDani07 Lv 1 1 pt. 678
  3. Avatar for tyxf1139 243. tyxf1139 Lv 1 1 pt. 0
  4. Avatar for agnairt 244. agnairt Lv 1 1 pt. 0
  5. Avatar for Bierworst 245. Bierworst Lv 1 1 pt. 0
  6. Avatar for tairon 246. tairon Lv 1 1 pt. 0
  7. Avatar for TheMobb 247. TheMobb Lv 1 1 pt. 0
  8. Avatar for Densond 248. Densond Lv 1 1 pt. 0
  9. Avatar for baptmax 249. baptmax Lv 1 1 pt. 0
  10. Avatar for Reldas 250. Reldas Lv 1 1 pt. 0

Comments