Placeholder image of a protein
Icon representing a puzzle

1116: Revisiting Puzzle 83: Cardiotoxin

Closed since over 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
July 21, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Top groups


  1. Avatar for Beta Folders 100 pts. 9,494
  2. Avatar for Go Science 2. Go Science 78 pts. 9,312
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 60 pts. 9,310
  4. Avatar for Contenders 4. Contenders 45 pts. 9,275
  5. Avatar for Gargleblasters 5. Gargleblasters 33 pts. 9,265
  6. Avatar for Deleted group 6. Deleted group pts. 9,209
  7. Avatar for Void Crushers 7. Void Crushers 17 pts. 9,196
  8. Avatar for HMT heritage 8. HMT heritage 12 pts. 9,169
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 8 pts. 9,166
  10. Avatar for Deleted group 10. Deleted group pts. 8,865

  1. Avatar for nicobul 31. nicobul Lv 1 53 pts. 9,090
  2. Avatar for Skippysk8s 32. Skippysk8s Lv 1 52 pts. 9,080
  3. Avatar for mimi 33. mimi Lv 1 51 pts. 9,059
  4. Avatar for Blipperman 34. Blipperman Lv 1 50 pts. 9,058
  5. Avatar for dcrwheeler 35. dcrwheeler Lv 1 49 pts. 9,057
  6. Avatar for g_b 36. g_b Lv 1 48 pts. 9,045
  7. Avatar for uhuuhu 37. uhuuhu Lv 1 46 pts. 9,033
  8. Avatar for jamiexq 38. jamiexq Lv 1 45 pts. 9,012
  9. Avatar for christioanchauvin 39. christioanchauvin Lv 1 44 pts. 9,010
  10. Avatar for gurra66 40. gurra66 Lv 1 43 pts. 8,998

Comments