Placeholder image of a protein
Icon representing a puzzle

1116: Revisiting Puzzle 83: Cardiotoxin

Closed since over 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
July 21, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Top groups


  1. Avatar for Beta Folders 100 pts. 9,494
  2. Avatar for Go Science 2. Go Science 78 pts. 9,312
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 60 pts. 9,310
  4. Avatar for Contenders 4. Contenders 45 pts. 9,275
  5. Avatar for Gargleblasters 5. Gargleblasters 33 pts. 9,265
  6. Avatar for Deleted group 6. Deleted group pts. 9,209
  7. Avatar for Void Crushers 7. Void Crushers 17 pts. 9,196
  8. Avatar for HMT heritage 8. HMT heritage 12 pts. 9,169
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 8 pts. 9,166
  10. Avatar for Deleted group 10. Deleted group pts. 8,865

  1. Avatar for Museka 51. Museka Lv 1 33 pts. 8,949
  2. Avatar for gloverd 52. gloverd Lv 1 32 pts. 8,932
  3. Avatar for isaksson 53. isaksson Lv 1 32 pts. 8,919
  4. Avatar for hansvandenhof 54. hansvandenhof Lv 1 31 pts. 8,915
  5. Avatar for crpainter 55. crpainter Lv 1 30 pts. 8,914
  6. Avatar for pauldunn 56. pauldunn Lv 1 29 pts. 8,898
  7. Avatar for pvc78 57. pvc78 Lv 1 29 pts. 8,897
  8. Avatar for actiasluna 58. actiasluna Lv 1 28 pts. 8,883
  9. Avatar for Deleted player 59. Deleted player 27 pts. 8,883
  10. Avatar for stomjoh 60. stomjoh Lv 1 27 pts. 8,871

Comments