Placeholder image of a protein
Icon representing a puzzle

1119: Revisiting Puzzle 84: Giant Anemone

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
July 27, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, which is released by the sea anemone A. xanthogrammica, disrupts normal contraction of cardiac muscle in potential predators, and furthermore serves as a pheromone to signal danger to nearby anemones. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ

Top groups

  1. Avatar for HMT heritage 11. HMT heritage 6 pts. 8,907
  2. Avatar for Natural Abilities 12. Natural Abilities 4 pts. 8,621
  3. Avatar for Russian team 13. Russian team 3 pts. 8,311
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 2 pts. 8,306
  5. Avatar for freefolder 15. freefolder 1 pt. 8,297
  6. Avatar for xkcd 16. xkcd 1 pt. 8,231
  7. Avatar for BOINC@Poland 17. BOINC@Poland 1 pt. 8,203
  8. Avatar for It's over 9000! 18. It's over 9000! 1 pt. 8,058
  9. Avatar for foldeRNA 19. foldeRNA 1 pt. 7,822
  10. Avatar for Minions of TWIS 20. Minions of TWIS 1 pt. 7,695
  1. Avatar for actiasluna 31. actiasluna Lv 1 53 pts. 9,077
  2. Avatar for Vredeman 32. Vredeman Lv 1 52 pts. 9,077
  3. Avatar for christioanchauvin 33. christioanchauvin Lv 1 50 pts. 9,076
  4. Avatar for uhuuhu 34. uhuuhu Lv 1 49 pts. 9,053
  5. Avatar for Amphimixus 35. Amphimixus Lv 1 48 pts. 9,052
  6. Avatar for dcrwheeler 36. dcrwheeler Lv 1 47 pts. 9,044
  7. Avatar for Timo van der Laan 37. Timo van der Laan Lv 1 46 pts. 9,039
  8. Avatar for Norrjane 38. Norrjane Lv 1 45 pts. 9,034
  9. Avatar for DodoBird 39. DodoBird Lv 1 44 pts. 9,032
  10. Avatar for smilingone 40. smilingone Lv 1 43 pts. 9,022

Comments