Placeholder image of a protein
Icon representing a puzzle

1119: Revisiting Puzzle 84: Giant Anemone

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
July 27, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, which is released by the sea anemone A. xanthogrammica, disrupts normal contraction of cardiac muscle in potential predators, and furthermore serves as a pheromone to signal danger to nearby anemones. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,236
  2. Avatar for Go Science 2. Go Science 81 pts. 9,190
  3. Avatar for Beta Folders 3. Beta Folders 64 pts. 9,187
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 50 pts. 9,180
  5. Avatar for Gargleblasters 5. Gargleblasters 39 pts. 9,180
  6. Avatar for Contenders 6. Contenders 30 pts. 9,178
  7. Avatar for Void Crushers 7. Void Crushers 23 pts. 9,115
  8. Avatar for Deleted group 8. Deleted group pts. 9,093
  9. Avatar for Deleted group 9. Deleted group pts. 9,052
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 9 pts. 8,907

  1. Avatar for actiasluna 31. actiasluna Lv 1 53 pts. 9,077
  2. Avatar for Vredeman 32. Vredeman Lv 1 52 pts. 9,077
  3. Avatar for christioanchauvin 33. christioanchauvin Lv 1 50 pts. 9,076
  4. Avatar for uhuuhu 34. uhuuhu Lv 1 49 pts. 9,053
  5. Avatar for Amphimixus 35. Amphimixus Lv 1 48 pts. 9,052
  6. Avatar for dcrwheeler 36. dcrwheeler Lv 1 47 pts. 9,044
  7. Avatar for Timo van der Laan 37. Timo van der Laan Lv 1 46 pts. 9,039
  8. Avatar for Norrjane 38. Norrjane Lv 1 45 pts. 9,034
  9. Avatar for DodoBird 39. DodoBird Lv 1 44 pts. 9,032
  10. Avatar for smilingone 40. smilingone Lv 1 43 pts. 9,022

Comments