Placeholder image of a protein
Icon representing a puzzle

1119: Revisiting Puzzle 84: Giant Anemone

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
July 27, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, which is released by the sea anemone A. xanthogrammica, disrupts normal contraction of cardiac muscle in potential predators, and furthermore serves as a pheromone to signal danger to nearby anemones. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ

Top groups


  1. Avatar for Jorks! 21. Jorks! 1 pt. 7,685
  2. Avatar for CureCoin 22. CureCoin 1 pt. 7,192
  3. Avatar for DSN @ Home 23. DSN @ Home 1 pt. 7,114
  4. Avatar for Window Group 24. Window Group 1 pt. 3,370

  1. Avatar for MaartenDesnouck 111. MaartenDesnouck Lv 1 6 pts. 8,315
  2. Avatar for Grom 112. Grom Lv 1 6 pts. 8,311
  3. Avatar for Jajaboman 113. Jajaboman Lv 1 5 pts. 8,306
  4. Avatar for Imeturoran 114. Imeturoran Lv 1 5 pts. 8,297
  5. Avatar for andrewxc 115. andrewxc Lv 1 5 pts. 8,265
  6. Avatar for Satina 116. Satina Lv 1 5 pts. 8,257
  7. Avatar for ManVsYard 117. ManVsYard Lv 1 5 pts. 8,241
  8. Avatar for fryguy 118. fryguy Lv 1 5 pts. 8,231
  9. Avatar for proteansoup 119. proteansoup Lv 1 4 pts. 8,221
  10. Avatar for leehaggis 120. leehaggis Lv 1 4 pts. 8,208

Comments