Placeholder image of a protein
Icon representing a puzzle

1119: Revisiting Puzzle 84: Giant Anemone

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
July 27, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, which is released by the sea anemone A. xanthogrammica, disrupts normal contraction of cardiac muscle in potential predators, and furthermore serves as a pheromone to signal danger to nearby anemones. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ

Top groups

  1. Avatar for Jorks! 21. Jorks! 1 pt. 7,685
  2. Avatar for CureCoin 22. CureCoin 1 pt. 7,192
  3. Avatar for DSN @ Home 23. DSN @ Home 1 pt. 7,114
  4. Avatar for Window Group 24. Window Group 1 pt. 3,370
  1. Avatar for AryehK 131. AryehK Lv 1 3 pts. 8,043
  2. Avatar for dettingen 132. dettingen Lv 1 3 pts. 8,038
  3. Avatar for rezaefar 133. rezaefar Lv 1 3 pts. 8,018
  4. Avatar for bwkittitas 134. bwkittitas Lv 1 3 pts. 8,016
  5. Avatar for NotJim99 135. NotJim99 Lv 1 3 pts. 8,000
  6. Avatar for lange 136. lange Lv 1 2 pts. 8,000
  7. Avatar for 01010011111 137. 01010011111 Lv 1 2 pts. 7,981
  8. Avatar for rinze 138. rinze Lv 1 2 pts. 7,963
  9. Avatar for ViJay7019 139. ViJay7019 Lv 1 2 pts. 7,949
  10. Avatar for JUMELLE54 140. JUMELLE54 Lv 1 2 pts. 7,941

Comments