Placeholder image of a protein
Icon representing a puzzle

1119: Revisiting Puzzle 84: Giant Anemone

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
July 27, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, which is released by the sea anemone A. xanthogrammica, disrupts normal contraction of cardiac muscle in potential predators, and furthermore serves as a pheromone to signal danger to nearby anemones. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ

Top groups

  1. Avatar for Jorks! 21. Jorks! 1 pt. 7,685
  2. Avatar for CureCoin 22. CureCoin 1 pt. 7,192
  3. Avatar for DSN @ Home 23. DSN @ Home 1 pt. 7,114
  4. Avatar for Window Group 24. Window Group 1 pt. 3,370
  1. Avatar for jebbiek 151. jebbiek Lv 1 1 pt. 7,758
  2. Avatar for Inkedhands 152. Inkedhands Lv 1 1 pt. 7,756
  3. Avatar for Hongmiao Hu 153. Hongmiao Hu Lv 1 1 pt. 7,751
  4. Avatar for val.sch67 154. val.sch67 Lv 1 1 pt. 7,749
  5. Avatar for Arne Heessels 155. Arne Heessels Lv 1 1 pt. 7,729
  6. Avatar for hada 156. hada Lv 1 1 pt. 7,717
  7. Avatar for pandabearsecond 157. pandabearsecond Lv 1 1 pt. 7,711
  8. Avatar for Tyggy Too 158. Tyggy Too Lv 1 1 pt. 7,704
  9. Avatar for gldisater 159. gldisater Lv 1 1 pt. 7,695
  10. Avatar for Hansie 160. Hansie Lv 1 1 pt. 7,693

Comments