Placeholder image of a protein
Icon representing a puzzle

1119: Revisiting Puzzle 84: Giant Anemone

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
July 27, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, which is released by the sea anemone A. xanthogrammica, disrupts normal contraction of cardiac muscle in potential predators, and furthermore serves as a pheromone to signal danger to nearby anemones. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ

Top groups

  1. Avatar for Jorks! 21. Jorks! 1 pt. 7,685
  2. Avatar for CureCoin 22. CureCoin 1 pt. 7,192
  3. Avatar for DSN @ Home 23. DSN @ Home 1 pt. 7,114
  4. Avatar for Window Group 24. Window Group 1 pt. 3,370
  1. Avatar for Close At Hand 161. Close At Hand Lv 1 1 pt. 7,687
  2. Avatar for dochs 162. dochs Lv 1 1 pt. 7,685
  3. Avatar for DScott 163. DScott Lv 1 1 pt. 7,677
  4. Avatar for Duke_K 164. Duke_K Lv 1 1 pt. 7,670
  5. Avatar for Master_Assassian 165. Master_Assassian Lv 1 1 pt. 7,641
  6. Avatar for cnhrcolemam 166. cnhrcolemam Lv 1 1 pt. 7,627
  7. Avatar for boondog 167. boondog Lv 1 1 pt. 7,625
  8. Avatar for mirjamvandelft 168. mirjamvandelft Lv 1 1 pt. 7,612
  9. Avatar for _Cyber_ 169. _Cyber_ Lv 1 1 pt. 7,606
  10. Avatar for Worlds Strongest Gamer 170. Worlds Strongest Gamer Lv 1 1 pt. 7,602

Comments