Placeholder image of a protein
Icon representing a puzzle

1119: Revisiting Puzzle 84: Giant Anemone

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
July 27, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, which is released by the sea anemone A. xanthogrammica, disrupts normal contraction of cardiac muscle in potential predators, and furthermore serves as a pheromone to signal danger to nearby anemones. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ

Top groups

  1. Avatar for Jorks! 21. Jorks! 1 pt. 7,685
  2. Avatar for CureCoin 22. CureCoin 1 pt. 7,192
  3. Avatar for DSN @ Home 23. DSN @ Home 1 pt. 7,114
  4. Avatar for Window Group 24. Window Group 1 pt. 3,370
  1. Avatar for franse 171. franse Lv 1 1 pt. 7,594
  2. Avatar for jencimons 172. jencimons Lv 1 1 pt. 7,591
  3. Avatar for Joryell 173. Joryell Lv 1 1 pt. 7,577
  4. Avatar for bamh 174. bamh Lv 1 1 pt. 7,575
  5. Avatar for Sydefecks 175. Sydefecks Lv 1 1 pt. 7,571
  6. Avatar for Altercomp 176. Altercomp Lv 1 1 pt. 7,570
  7. Avatar for Maru67 177. Maru67 Lv 1 1 pt. 7,563
  8. Avatar for Andi1960 178. Andi1960 Lv 1 1 pt. 7,553
  9. Avatar for Idriel007 179. Idriel007 Lv 1 1 pt. 7,536
  10. Avatar for JWNoctis 180. JWNoctis Lv 1 1 pt. 7,517

Comments