Placeholder image of a protein
Icon representing a puzzle

1119: Revisiting Puzzle 84: Giant Anemone

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
July 27, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, which is released by the sea anemone A. xanthogrammica, disrupts normal contraction of cardiac muscle in potential predators, and furthermore serves as a pheromone to signal danger to nearby anemones. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ

Top groups


  1. Avatar for Jorks! 21. Jorks! 1 pt. 7,685
  2. Avatar for CureCoin 22. CureCoin 1 pt. 7,192
  3. Avatar for DSN @ Home 23. DSN @ Home 1 pt. 7,114
  4. Avatar for Window Group 24. Window Group 1 pt. 3,370

  1. Avatar for Jaxon 201. Jaxon Lv 1 1 pt. 7,214
  2. Avatar for petersocha 202. petersocha Lv 1 1 pt. 7,206
  3. Avatar for Tac1 203. Tac1 Lv 1 1 pt. 7,202
  4. Avatar for smarthuman 204. smarthuman Lv 1 1 pt. 7,192
  5. Avatar for cor2020 205. cor2020 Lv 1 1 pt. 7,190
  6. Avatar for Kelly Barnett 206. Kelly Barnett Lv 1 1 pt. 7,184
  7. Avatar for Jumbly 207. Jumbly Lv 1 1 pt. 7,165
  8. Avatar for DeathBringa 208. DeathBringa Lv 1 1 pt. 7,144
  9. Avatar for ewelina2909 209. ewelina2909 Lv 1 1 pt. 7,123
  10. Avatar for aspadistra 210. aspadistra Lv 1 1 pt. 7,114

Comments