Placeholder image of a protein
Icon representing a puzzle

1119: Revisiting Puzzle 84: Giant Anemone

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
July 27, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, which is released by the sea anemone A. xanthogrammica, disrupts normal contraction of cardiac muscle in potential predators, and furthermore serves as a pheromone to signal danger to nearby anemones. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ

Top groups

  1. Avatar for Jorks! 21. Jorks! 1 pt. 7,685
  2. Avatar for CureCoin 22. CureCoin 1 pt. 7,192
  3. Avatar for DSN @ Home 23. DSN @ Home 1 pt. 7,114
  4. Avatar for Window Group 24. Window Group 1 pt. 3,370
  1. Avatar for dreadchem 211. dreadchem Lv 1 1 pt. 7,111
  2. Avatar for alWey 212. alWey Lv 1 1 pt. 7,087
  3. Avatar for zizaitianmo 213. zizaitianmo Lv 1 1 pt. 7,065
  4. Avatar for brgreening 214. brgreening Lv 1 1 pt. 7,062
  5. Avatar for sheepzors 215. sheepzors Lv 1 1 pt. 7,035
  6. Avatar for 3poke 216. 3poke Lv 1 1 pt. 6,986
  7. Avatar for Mike Cassidy 217. Mike Cassidy Lv 1 1 pt. 6,931
  8. Avatar for Vampyricon 218. Vampyricon Lv 1 1 pt. 6,930
  9. Avatar for Belah 219. Belah Lv 1 1 pt. 6,894
  10. Avatar for perrystaff 220. perrystaff Lv 1 1 pt. 6,876

Comments