Placeholder image of a protein
Icon representing a puzzle

1119: Revisiting Puzzle 84: Giant Anemone

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
July 27, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, which is released by the sea anemone A. xanthogrammica, disrupts normal contraction of cardiac muscle in potential predators, and furthermore serves as a pheromone to signal danger to nearby anemones. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ

Top groups

  1. Avatar for Jorks! 21. Jorks! 1 pt. 7,685
  2. Avatar for CureCoin 22. CureCoin 1 pt. 7,192
  3. Avatar for DSN @ Home 23. DSN @ Home 1 pt. 7,114
  4. Avatar for Window Group 24. Window Group 1 pt. 3,370
  1. Avatar for francesco.patane 231. francesco.patane Lv 1 1 pt. 6,314
  2. Avatar for vctionco 232. vctionco Lv 1 1 pt. 6,237
  3. Avatar for Jvoljvolizka 233. Jvoljvolizka Lv 1 1 pt. 6,106
  4. Avatar for jkmills78 234. jkmills78 Lv 1 1 pt. 5,903
  5. Avatar for SSK_CSGO 235. SSK_CSGO Lv 1 1 pt. 5,075
  6. Avatar for joshuak2016 236. joshuak2016 Lv 1 1 pt. 4,286
  7. Avatar for dflear 237. dflear Lv 1 1 pt. 3,370
  8. Avatar for vineethg 238. vineethg Lv 1 1 pt. 3,370
  9. Avatar for agnairt 239. agnairt Lv 1 1 pt. 3,370
  10. Avatar for jflat06 240. jflat06 Lv 1 1 pt. 3,370

Comments