Placeholder image of a protein
Icon representing a puzzle

1119: Revisiting Puzzle 84: Giant Anemone

Closed since almost 11 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
July 27, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, which is released by the sea anemone A. xanthogrammica, disrupts normal contraction of cardiac muscle in potential predators, and furthermore serves as a pheromone to signal danger to nearby anemones. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ

Top groups


  1. Avatar for Jorks! 21. Jorks! 1 pt. 7,685
  2. Avatar for CureCoin 22. CureCoin 1 pt. 7,192
  3. Avatar for DSN @ Home 23. DSN @ Home 1 pt. 7,114
  4. Avatar for Window Group 24. Window Group 1 pt. 3,370

  1. Avatar for packer 241. packer Lv 1 1 pt. 3,370
  2. Avatar for Ashrai 242. Ashrai Lv 1 1 pt. 3,370
  3. Avatar for ari.m 243. ari.m Lv 1 1 pt. 3,370
  4. Avatar for KiroYakuza349 244. KiroYakuza349 Lv 1 1 pt. 3,370
  5. Avatar for gaving1 245. gaving1 Lv 1 1 pt. 3,370
  6. Avatar for karost 246. karost Lv 1 1 pt. 3,370
  7. Avatar for daito 247. daito Lv 1 1 pt. 3,370
  8. Avatar for CrispyCream 248. CrispyCream Lv 1 1 pt. 3,370

Comments