Placeholder image of a protein
Icon representing a puzzle

1119: Revisiting Puzzle 84: Giant Anemone

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
July 27, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, which is released by the sea anemone A. xanthogrammica, disrupts normal contraction of cardiac muscle in potential predators, and furthermore serves as a pheromone to signal danger to nearby anemones. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ

Top groups

  1. Avatar for Jorks! 21. Jorks! 1 pt. 7,685
  2. Avatar for CureCoin 22. CureCoin 1 pt. 7,192
  3. Avatar for DSN @ Home 23. DSN @ Home 1 pt. 7,114
  4. Avatar for Window Group 24. Window Group 1 pt. 3,370
  1. Avatar for mimi 21. mimi Lv 1 66 pts. 9,119
  2. Avatar for steveB 22. steveB Lv 1 65 pts. 9,115
  3. Avatar for sheerbliss 23. sheerbliss Lv 1 63 pts. 9,108
  4. Avatar for gitwut 24. gitwut Lv 1 62 pts. 9,107
  5. Avatar for Paulo Roque 25. Paulo Roque Lv 1 60 pts. 9,106
  6. Avatar for Bruno Kestemont 26. Bruno Kestemont Lv 1 59 pts. 9,097
  7. Avatar for ponderosa 27. ponderosa Lv 1 58 pts. 9,092
  8. Avatar for Aubade01 28. Aubade01 Lv 1 57 pts. 9,090
  9. Avatar for Deleted player 29. Deleted player pts. 9,089
  10. Avatar for KarenCH 30. KarenCH Lv 1 54 pts. 9,088

Comments