Placeholder image of a protein
Icon representing a puzzle

1119: Revisiting Puzzle 84: Giant Anemone

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
July 27, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, which is released by the sea anemone A. xanthogrammica, disrupts normal contraction of cardiac muscle in potential predators, and furthermore serves as a pheromone to signal danger to nearby anemones. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ

Top groups

  1. Avatar for Jorks! 21. Jorks! 1 pt. 7,685
  2. Avatar for CureCoin 22. CureCoin 1 pt. 7,192
  3. Avatar for DSN @ Home 23. DSN @ Home 1 pt. 7,114
  4. Avatar for Window Group 24. Window Group 1 pt. 3,370
  1. Avatar for gmn 41. gmn Lv 1 42 pts. 9,015
  2. Avatar for hansvandenhof 42. hansvandenhof Lv 1 41 pts. 9,013
  3. Avatar for martin.szew 43. martin.szew Lv 1 40 pts. 9,008
  4. Avatar for Sissue 44. Sissue Lv 1 39 pts. 8,998
  5. Avatar for Deleted player 45. Deleted player 38 pts. 8,990
  6. Avatar for reefyrob 46. reefyrob Lv 1 37 pts. 8,989
  7. Avatar for jamiexq 47. jamiexq Lv 1 36 pts. 8,988
  8. Avatar for pvc78 48. pvc78 Lv 1 35 pts. 8,985
  9. Avatar for jobo0502 49. jobo0502 Lv 1 34 pts. 8,979
  10. Avatar for Crossed Sticks 50. Crossed Sticks Lv 1 34 pts. 8,967

Comments