Placeholder image of a protein
Icon representing a puzzle

1119: Revisiting Puzzle 84: Giant Anemone

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
July 27, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, which is released by the sea anemone A. xanthogrammica, disrupts normal contraction of cardiac muscle in potential predators, and furthermore serves as a pheromone to signal danger to nearby anemones. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ

Top groups


  1. Avatar for Jorks! 21. Jorks! 1 pt. 7,685
  2. Avatar for CureCoin 22. CureCoin 1 pt. 7,192
  3. Avatar for DSN @ Home 23. DSN @ Home 1 pt. 7,114
  4. Avatar for Window Group 24. Window Group 1 pt. 3,370

  1. Avatar for brow42 51. brow42 Lv 1 33 pts. 8,958
  2. Avatar for Museka 52. Museka Lv 1 32 pts. 8,952
  3. Avatar for greepski 53. greepski Lv 1 31 pts. 8,947
  4. Avatar for nemo7731 54. nemo7731 Lv 1 30 pts. 8,945
  5. Avatar for caglar 55. caglar Lv 1 30 pts. 8,944
  6. Avatar for jdormaar 56. jdormaar Lv 1 29 pts. 8,907
  7. Avatar for crpainter 57. crpainter Lv 1 28 pts. 8,906
  8. Avatar for O Seki To 58. O Seki To Lv 1 27 pts. 8,889
  9. Avatar for shettler 59. shettler Lv 1 27 pts. 8,886
  10. Avatar for johngran 60. johngran Lv 1 26 pts. 8,875

Comments