Placeholder image of a protein
Icon representing a puzzle

1119: Revisiting Puzzle 84: Giant Anemone

Closed since almost 11 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
July 27, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, which is released by the sea anemone A. xanthogrammica, disrupts normal contraction of cardiac muscle in potential predators, and furthermore serves as a pheromone to signal danger to nearby anemones. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,236
  2. Avatar for Go Science 2. Go Science 81 pts. 9,190
  3. Avatar for Beta Folders 3. Beta Folders 64 pts. 9,187
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 50 pts. 9,180
  5. Avatar for Gargleblasters 5. Gargleblasters 39 pts. 9,180
  6. Avatar for Contenders 6. Contenders 30 pts. 9,178
  7. Avatar for Void Crushers 7. Void Crushers 23 pts. 9,115
  8. Avatar for Deleted group 8. Deleted group pts. 9,093
  9. Avatar for Deleted group 9. Deleted group pts. 9,052
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 9 pts. 8,907

  1. Avatar for PrettyPony2001 91. PrettyPony2001 Lv 1 11 pts. 8,612
  2. Avatar for phi16 92. phi16 Lv 1 11 pts. 8,611
  3. Avatar for smholst 93. smholst Lv 1 10 pts. 8,582
  4. Avatar for alwen 94. alwen Lv 1 10 pts. 8,580
  5. Avatar for pfeiffelfloyd 95. pfeiffelfloyd Lv 1 10 pts. 8,564
  6. Avatar for fishercat 96. fishercat Lv 1 9 pts. 8,550
  7. Avatar for arginia 97. arginia Lv 1 9 pts. 8,511
  8. Avatar for Festering Wounds 99. Festering Wounds Lv 1 8 pts. 8,479
  9. Avatar for Mohambone 100. Mohambone Lv 1 8 pts. 8,469

Comments