Placeholder image of a protein
Icon representing a puzzle

1119: Revisiting Puzzle 84: Giant Anemone

Closed since almost 11 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
July 27, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, which is released by the sea anemone A. xanthogrammica, disrupts normal contraction of cardiac muscle in potential predators, and furthermore serves as a pheromone to signal danger to nearby anemones. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,236
  2. Avatar for Go Science 2. Go Science 81 pts. 9,190
  3. Avatar for Beta Folders 3. Beta Folders 64 pts. 9,187
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 50 pts. 9,180
  5. Avatar for Gargleblasters 5. Gargleblasters 39 pts. 9,180
  6. Avatar for Contenders 6. Contenders 30 pts. 9,178
  7. Avatar for Void Crushers 7. Void Crushers 23 pts. 9,115
  8. Avatar for Deleted group 8. Deleted group pts. 9,093
  9. Avatar for Deleted group 9. Deleted group pts. 9,052
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 9 pts. 8,907

  1. Avatar for kitek314_pl 121. kitek314_pl Lv 1 4 pts. 8,203
  2. Avatar for RyeSnake 122. RyeSnake Lv 1 4 pts. 8,203
  3. Avatar for dahast.de 123. dahast.de Lv 1 4 pts. 8,200
  4. Avatar for Punktchen 124. Punktchen Lv 1 4 pts. 8,172
  5. Avatar for Soggy Doglog 125. Soggy Doglog Lv 1 4 pts. 8,171
  6. Avatar for navn 126. navn Lv 1 3 pts. 8,153
  7. Avatar for Giant Berk 127. Giant Berk Lv 1 3 pts. 8,125
  8. Avatar for emdee314 128. emdee314 Lv 1 3 pts. 8,111
  9. Avatar for marie.p 129. marie.p Lv 1 3 pts. 8,071
  10. Avatar for BCAA 130. BCAA Lv 1 3 pts. 8,058

Comments