1119: Revisiting Puzzle 84: Giant Anemone

Closed since over 10 years ago

Summary

• Created: July 27, 2015
• Expires: August 04, 2015 at 11:00 UTC
• Max points: 100

Description

This is a throwback puzzle to the early days of Foldit. This toxin, which is released by the sea anemone A. xanthogrammica, disrupts normal contraction of cardiac muscle in potential predators, and furthermore serves as a pheromone to signal danger to nearby anemones. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ

Top groups

• 1. Anthropic Dreams 100 pts. 9,236
• 2. Go Science 81 pts. 9,190
• 3. Beta Folders 64 pts. 9,187
• 4. L'Alliance Francophone 50 pts. 9,180
• 5. Gargleblasters 39 pts. 9,180
• 6. Contenders 30 pts. 9,178
• 7. Void Crushers 23 pts. 9,115
• 8. Deleted group pts. 9,093
• 9. Deleted group pts. 9,052
• 10. Italiani Al Lavoro 9 pts. 8,907

Top soloists

• 11. LociOiling 82 pts. 9,153
• 12. jermainiac 80 pts. 9,139
• 13. pauldunn 78 pts. 9,138
• 14. aznarog 77 pts. 9,137
• 15. bertro 75 pts. 9,131
• 16. Lindata 74 pts. 9,130
• 17. Galaxie 72 pts. 9,129
• 18. johnmitch 71 pts. 9,126
• 19. mirp 69 pts. 9,125
• 20. gloverd 68 pts. 9,123