1122: Revisiting Puzzle 85: Cell Adhesion Protein
Closed since over 10 years ago
Intermediate Overall PredictionSummary
- Created
- August 03, 2015
- Expires
- Max points
- 100
This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein that mediates interactions between other proteins in human development. This protein contains several cysteine residues, but we'd like to model them in a reducing environment, so they should NOT form disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.
Sequence:
MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC