Placeholder image of a protein
Icon representing a puzzle

1122: Revisiting Puzzle 85: Cell Adhesion Protein

Closed since over 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
August 03, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein that mediates interactions between other proteins in human development. This protein contains several cysteine residues, but we'd like to model them in a reducing environment, so they should NOT form disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC

Top groups


  1. Avatar for HMT heritage 11. HMT heritage 4 pts. 8,038
  2. Avatar for BOINC@Poland 12. BOINC@Poland 3 pts. 7,960
  3. Avatar for Deleted group 13. Deleted group pts. 7,906
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 7,903
  5. Avatar for Russian team 15. Russian team 1 pt. 7,799
  6. Avatar for ROMANIA Team 16. ROMANIA Team 1 pt. 7,771
  7. Avatar for freefolder 17. freefolder 1 pt. 7,608
  8. Avatar for Czech National Team 18. Czech National Team 1 pt. 7,403
  9. Avatar for Minions of TWIS 19. Minions of TWIS 1 pt. 7,225
  10. Avatar for Geekdo 20. Geekdo 1 pt. 7,110

  1. Avatar for pauldunn
    1. pauldunn Lv 1
    100 pts. 8,514
  2. Avatar for Vredeman 2. Vredeman Lv 1 98 pts. 8,481
  3. Avatar for cbwest 3. cbwest Lv 1 96 pts. 8,468
  4. Avatar for nicobul 4. nicobul Lv 1 94 pts. 8,444
  5. Avatar for retiredmichael 5. retiredmichael Lv 1 91 pts. 8,440
  6. Avatar for Timo van der Laan 6. Timo van der Laan Lv 1 89 pts. 8,439
  7. Avatar for Skippysk8s 7. Skippysk8s Lv 1 87 pts. 8,432
  8. Avatar for g_b 8. g_b Lv 1 85 pts. 8,417
  9. Avatar for frood66 9. frood66 Lv 1 83 pts. 8,414
  10. Avatar for johnmitch 10. johnmitch Lv 1 81 pts. 8,409

Comments