Placeholder image of a protein
Icon representing a puzzle

1122: Revisiting Puzzle 85: Cell Adhesion Protein

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
August 03, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein that mediates interactions between other proteins in human development. This protein contains several cysteine residues, but we'd like to model them in a reducing environment, so they should NOT form disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC

Top groups


  1. Avatar for HMT heritage 11. HMT heritage 4 pts. 8,038
  2. Avatar for BOINC@Poland 12. BOINC@Poland 3 pts. 7,960
  3. Avatar for Deleted group 13. Deleted group pts. 7,906
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 7,903
  5. Avatar for Russian team 15. Russian team 1 pt. 7,799
  6. Avatar for ROMANIA Team 16. ROMANIA Team 1 pt. 7,771
  7. Avatar for freefolder 17. freefolder 1 pt. 7,608
  8. Avatar for Czech National Team 18. Czech National Team 1 pt. 7,403
  9. Avatar for Minions of TWIS 19. Minions of TWIS 1 pt. 7,225
  10. Avatar for Geekdo 20. Geekdo 1 pt. 7,110

  1. Avatar for Amphimixus 101. Amphimixus Lv 1 5 pts. 7,906
  2. Avatar for ViJay7019 102. ViJay7019 Lv 1 4 pts. 7,903
  3. Avatar for DScott 103. DScott Lv 1 4 pts. 7,892
  4. Avatar for weitzen 104. weitzen Lv 1 4 pts. 7,891
  5. Avatar for smholst 105. smholst Lv 1 4 pts. 7,872
  6. Avatar for packer 106. packer Lv 1 4 pts. 7,869
  7. Avatar for Arne Heessels 107. Arne Heessels Lv 1 4 pts. 7,865
  8. Avatar for MaartenDesnouck 108. MaartenDesnouck Lv 1 3 pts. 7,861
  9. Avatar for drumpeter18yrs9yrs 109. drumpeter18yrs9yrs Lv 1 3 pts. 7,858
  10. Avatar for pfirth 110. pfirth Lv 1 3 pts. 7,854

Comments