Placeholder image of a protein
Icon representing a puzzle

1122: Revisiting Puzzle 85: Cell Adhesion Protein

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
August 03, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein that mediates interactions between other proteins in human development. This protein contains several cysteine residues, but we'd like to model them in a reducing environment, so they should NOT form disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC

Top groups

  1. Avatar for HMT heritage 11. HMT heritage 4 pts. 8,038
  2. Avatar for BOINC@Poland 12. BOINC@Poland 3 pts. 7,960
  3. Avatar for Deleted group 13. Deleted group pts. 7,906
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 7,903
  5. Avatar for Russian team 15. Russian team 1 pt. 7,799
  6. Avatar for ROMANIA Team 16. ROMANIA Team 1 pt. 7,771
  7. Avatar for freefolder 17. freefolder 1 pt. 7,608
  8. Avatar for Czech National Team 18. Czech National Team 1 pt. 7,403
  9. Avatar for Minions of TWIS 19. Minions of TWIS 1 pt. 7,225
  10. Avatar for Geekdo 20. Geekdo 1 pt. 7,110
  1. Avatar for Amyrhoo 161. Amyrhoo Lv 1 1 pt. 7,350
  2. Avatar for Tump 162. Tump Lv 1 1 pt. 7,348
  3. Avatar for Altercomp 163. Altercomp Lv 1 1 pt. 7,289
  4. Avatar for cnhrcolemam 164. cnhrcolemam Lv 1 1 pt. 7,285
  5. Avatar for martinf 165. martinf Lv 1 1 pt. 7,272
  6. Avatar for Sydefecks 166. Sydefecks Lv 1 1 pt. 7,265
  7. Avatar for FoolontheHill24 167. FoolontheHill24 Lv 1 1 pt. 7,237
  8. Avatar for gldisater 168. gldisater Lv 1 1 pt. 7,225
  9. Avatar for Stuffnex 169. Stuffnex Lv 1 1 pt. 7,214
  10. Avatar for Inkedhands 170. Inkedhands Lv 1 1 pt. 7,209

Comments