Placeholder image of a protein
Icon representing a puzzle

1122: Revisiting Puzzle 85: Cell Adhesion Protein

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
August 03, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein that mediates interactions between other proteins in human development. This protein contains several cysteine residues, but we'd like to model them in a reducing environment, so they should NOT form disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC

Top groups

  1. Avatar for HMT heritage 11. HMT heritage 4 pts. 8,038
  2. Avatar for BOINC@Poland 12. BOINC@Poland 3 pts. 7,960
  3. Avatar for Deleted group 13. Deleted group pts. 7,906
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 7,903
  5. Avatar for Russian team 15. Russian team 1 pt. 7,799
  6. Avatar for ROMANIA Team 16. ROMANIA Team 1 pt. 7,771
  7. Avatar for freefolder 17. freefolder 1 pt. 7,608
  8. Avatar for Czech National Team 18. Czech National Team 1 pt. 7,403
  9. Avatar for Minions of TWIS 19. Minions of TWIS 1 pt. 7,225
  10. Avatar for Geekdo 20. Geekdo 1 pt. 7,110
  1. Avatar for may of rose 181. may of rose Lv 1 1 pt. 7,009
  2. Avatar for dzaily0537 182. dzaily0537 Lv 1 1 pt. 6,998
  3. Avatar for DeathSpirit654 183. DeathSpirit654 Lv 1 1 pt. 6,991
  4. Avatar for sakotsu 184. sakotsu Lv 1 1 pt. 6,981
  5. Avatar for aspadistra 185. aspadistra Lv 1 1 pt. 6,965
  6. Avatar for karost 186. karost Lv 1 1 pt. 6,914
  7. Avatar for smarthuman 187. smarthuman Lv 1 1 pt. 6,907
  8. Avatar for 3poke 188. 3poke Lv 1 1 pt. 6,880
  9. Avatar for kodo690 189. kodo690 Lv 1 1 pt. 6,875
  10. Avatar for _Jelle 190. _Jelle Lv 1 1 pt. 6,875

Comments