Placeholder image of a protein
Icon representing a puzzle

1122: Revisiting Puzzle 85: Cell Adhesion Protein

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
August 03, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein that mediates interactions between other proteins in human development. This protein contains several cysteine residues, but we'd like to model them in a reducing environment, so they should NOT form disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC

Top groups

  1. Avatar for HMT heritage 11. HMT heritage 4 pts. 8,038
  2. Avatar for BOINC@Poland 12. BOINC@Poland 3 pts. 7,960
  3. Avatar for Deleted group 13. Deleted group pts. 7,906
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 7,903
  5. Avatar for Russian team 15. Russian team 1 pt. 7,799
  6. Avatar for ROMANIA Team 16. ROMANIA Team 1 pt. 7,771
  7. Avatar for freefolder 17. freefolder 1 pt. 7,608
  8. Avatar for Czech National Team 18. Czech National Team 1 pt. 7,403
  9. Avatar for Minions of TWIS 19. Minions of TWIS 1 pt. 7,225
  10. Avatar for Geekdo 20. Geekdo 1 pt. 7,110
  1. Avatar for Darkchild 191. Darkchild Lv 1 1 pt. 6,874
  2. Avatar for redyoshi49q 192. redyoshi49q Lv 1 1 pt. 6,868
  3. Avatar for brgreening 193. brgreening Lv 1 1 pt. 6,861
  4. Avatar for Gaming_Reaper 194. Gaming_Reaper Lv 1 1 pt. 6,845
  5. Avatar for Mike Cassidy 195. Mike Cassidy Lv 1 1 pt. 6,841
  6. Avatar for James.Ringler 196. James.Ringler Lv 1 1 pt. 6,840
  7. Avatar for Primus_Pilus 197. Primus_Pilus Lv 1 1 pt. 6,811
  8. Avatar for Yaddle 198. Yaddle Lv 1 1 pt. 6,789
  9. Avatar for bbmt 199. bbmt Lv 1 1 pt. 6,784
  10. Avatar for monoleuno2015 200. monoleuno2015 Lv 1 1 pt. 6,765

Comments