Placeholder image of a protein
Icon representing a puzzle

1122: Revisiting Puzzle 85: Cell Adhesion Protein

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
August 03, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein that mediates interactions between other proteins in human development. This protein contains several cysteine residues, but we'd like to model them in a reducing environment, so they should NOT form disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC

Top groups

  1. Avatar for HMT heritage 11. HMT heritage 4 pts. 8,038
  2. Avatar for BOINC@Poland 12. BOINC@Poland 3 pts. 7,960
  3. Avatar for Deleted group 13. Deleted group pts. 7,906
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 7,903
  5. Avatar for Russian team 15. Russian team 1 pt. 7,799
  6. Avatar for ROMANIA Team 16. ROMANIA Team 1 pt. 7,771
  7. Avatar for freefolder 17. freefolder 1 pt. 7,608
  8. Avatar for Czech National Team 18. Czech National Team 1 pt. 7,403
  9. Avatar for Minions of TWIS 19. Minions of TWIS 1 pt. 7,225
  10. Avatar for Geekdo 20. Geekdo 1 pt. 7,110
  1. Avatar for LociOiling 21. LociOiling Lv 1 61 pts. 8,361
  2. Avatar for christioanchauvin 22. christioanchauvin Lv 1 60 pts. 8,357
  3. Avatar for egran48 23. egran48 Lv 1 58 pts. 8,350
  4. Avatar for Deleted player 24. Deleted player 57 pts. 8,341
  5. Avatar for mirp 25. mirp Lv 1 55 pts. 8,338
  6. Avatar for stomjoh 26. stomjoh Lv 1 54 pts. 8,335
  7. Avatar for KarenCH 27. KarenCH Lv 1 52 pts. 8,318
  8. Avatar for pvc78 28. pvc78 Lv 1 51 pts. 8,317
  9. Avatar for RockOn 29. RockOn Lv 1 50 pts. 8,312
  10. Avatar for ponderosa 30. ponderosa Lv 1 48 pts. 8,292

Comments