Placeholder image of a protein
Icon representing a puzzle

1122: Revisiting Puzzle 85: Cell Adhesion Protein

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
August 03, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein that mediates interactions between other proteins in human development. This protein contains several cysteine residues, but we'd like to model them in a reducing environment, so they should NOT form disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC

Top groups

  1. Avatar for HMT heritage 11. HMT heritage 4 pts. 8,038
  2. Avatar for BOINC@Poland 12. BOINC@Poland 3 pts. 7,960
  3. Avatar for Deleted group 13. Deleted group pts. 7,906
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 7,903
  5. Avatar for Russian team 15. Russian team 1 pt. 7,799
  6. Avatar for ROMANIA Team 16. ROMANIA Team 1 pt. 7,771
  7. Avatar for freefolder 17. freefolder 1 pt. 7,608
  8. Avatar for Czech National Team 18. Czech National Team 1 pt. 7,403
  9. Avatar for Minions of TWIS 19. Minions of TWIS 1 pt. 7,225
  10. Avatar for Geekdo 20. Geekdo 1 pt. 7,110
  1. Avatar for reefyrob 41. reefyrob Lv 1 36 pts. 8,237
  2. Avatar for greepski 42. greepski Lv 1 35 pts. 8,237
  3. Avatar for pizpot 43. pizpot Lv 1 34 pts. 8,224
  4. Avatar for Crossed Sticks 44. Crossed Sticks Lv 1 33 pts. 8,223
  5. Avatar for crpainter 45. crpainter Lv 1 32 pts. 8,217
  6. Avatar for Sissue 46. Sissue Lv 1 31 pts. 8,211
  7. Avatar for sharondipity 47. sharondipity Lv 1 30 pts. 8,208
  8. Avatar for johngran 48. johngran Lv 1 29 pts. 8,206
  9. Avatar for steveB 49. steveB Lv 1 28 pts. 8,204
  10. Avatar for fishercat 50. fishercat Lv 1 27 pts. 8,198

Comments