Placeholder image of a protein
Icon representing a puzzle

1122: Revisiting Puzzle 85: Cell Adhesion Protein

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
August 03, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein that mediates interactions between other proteins in human development. This protein contains several cysteine residues, but we'd like to model them in a reducing environment, so they should NOT form disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC

Top groups


  1. Avatar for DSN @ Home 21. DSN @ Home 1 pt. 6,965
  2. Avatar for CureCoin 22. CureCoin 1 pt. 6,907

  1. Avatar for inkycatz 121. inkycatz Lv 1 2 pts. 7,747
  2. Avatar for Ernst Zundel 122. Ernst Zundel Lv 1 2 pts. 7,746
  3. Avatar for Pro Lapser 123. Pro Lapser Lv 1 2 pts. 7,742
  4. Avatar for Idiotboy 124. Idiotboy Lv 1 2 pts. 7,734
  5. Avatar for lange 125. lange Lv 1 2 pts. 7,728
  6. Avatar for jebbiek 126. jebbiek Lv 1 2 pts. 7,700
  7. Avatar for ncameron 127. ncameron Lv 1 2 pts. 7,685
  8. Avatar for dettingen 128. dettingen Lv 1 2 pts. 7,678
  9. Avatar for PrettyPony2001 129. PrettyPony2001 Lv 1 1 pt. 7,669
  10. Avatar for TJOK fan 130. TJOK fan Lv 1 1 pt. 7,663

Comments