Placeholder image of a protein
Icon representing a puzzle

1122: Revisiting Puzzle 85: Cell Adhesion Protein

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
August 03, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein that mediates interactions between other proteins in human development. This protein contains several cysteine residues, but we'd like to model them in a reducing environment, so they should NOT form disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC

Top groups


  1. Avatar for DSN @ Home 21. DSN @ Home 1 pt. 6,965
  2. Avatar for CureCoin 22. CureCoin 1 pt. 6,907

  1. Avatar for ManVsYard 131. ManVsYard Lv 1 1 pt. 7,654
  2. Avatar for FreeFolder 133. FreeFolder Lv 1 1 pt. 7,638
  3. Avatar for dbuske 134. dbuske Lv 1 1 pt. 7,637
  4. Avatar for senor pit 135. senor pit Lv 1 1 pt. 7,630
  5. Avatar for NameChangeNeeded01 136. NameChangeNeeded01 Lv 1 1 pt. 7,610
  6. Avatar for Imeturoran 137. Imeturoran Lv 1 1 pt. 7,608
  7. Avatar for NotJim99 138. NotJim99 Lv 1 1 pt. 7,602
  8. Avatar for Tyggy Too 139. Tyggy Too Lv 1 1 pt. 7,582
  9. Avatar for Mydogisa Toelicker 140. Mydogisa Toelicker Lv 1 1 pt. 7,577

Comments