Placeholder image of a protein
Icon representing a puzzle

1122: Revisiting Puzzle 85: Cell Adhesion Protein

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
August 03, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein that mediates interactions between other proteins in human development. This protein contains several cysteine residues, but we'd like to model them in a reducing environment, so they should NOT form disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC

Top groups

  1. Avatar for DSN @ Home 21. DSN @ Home 1 pt. 6,965
  2. Avatar for CureCoin 22. CureCoin 1 pt. 6,907
  1. Avatar for Amyrhoo 161. Amyrhoo Lv 1 1 pt. 7,350
  2. Avatar for Tump 162. Tump Lv 1 1 pt. 7,348
  3. Avatar for Altercomp 163. Altercomp Lv 1 1 pt. 7,289
  4. Avatar for cnhrcolemam 164. cnhrcolemam Lv 1 1 pt. 7,285
  5. Avatar for martinf 165. martinf Lv 1 1 pt. 7,272
  6. Avatar for Sydefecks 166. Sydefecks Lv 1 1 pt. 7,265
  7. Avatar for FoolontheHill24 167. FoolontheHill24 Lv 1 1 pt. 7,237
  8. Avatar for gldisater 168. gldisater Lv 1 1 pt. 7,225
  9. Avatar for Stuffnex 169. Stuffnex Lv 1 1 pt. 7,214
  10. Avatar for Inkedhands 170. Inkedhands Lv 1 1 pt. 7,209

Comments