Placeholder image of a protein
Icon representing a puzzle

1122: Revisiting Puzzle 85: Cell Adhesion Protein

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
August 03, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein that mediates interactions between other proteins in human development. This protein contains several cysteine residues, but we'd like to model them in a reducing environment, so they should NOT form disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC

Top groups

  1. Avatar for DSN @ Home 21. DSN @ Home 1 pt. 6,965
  2. Avatar for CureCoin 22. CureCoin 1 pt. 6,907
  1. Avatar for trentis1 171. trentis1 Lv 1 1 pt. 7,177
  2. Avatar for Infinity_Knight264 172. Infinity_Knight264 Lv 1 1 pt. 7,170
  3. Avatar for Deleted player 173. Deleted player 1 pt. 7,157
  4. Avatar for zezetel 174. zezetel Lv 1 1 pt. 7,139
  5. Avatar for Close At Hand 175. Close At Hand Lv 1 1 pt. 7,121
  6. Avatar for Tac1 176. Tac1 Lv 1 1 pt. 7,119
  7. Avatar for cor2020 177. cor2020 Lv 1 1 pt. 7,118
  8. Avatar for poiuyqwert 178. poiuyqwert Lv 1 1 pt. 7,114
  9. Avatar for salish99 179. salish99 Lv 1 1 pt. 7,110
  10. Avatar for franse 180. franse Lv 1 1 pt. 7,099

Comments