Placeholder image of a protein
Icon representing a puzzle

1122: Revisiting Puzzle 85: Cell Adhesion Protein

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
August 03, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein that mediates interactions between other proteins in human development. This protein contains several cysteine residues, but we'd like to model them in a reducing environment, so they should NOT form disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC

Top groups

  1. Avatar for DSN @ Home 21. DSN @ Home 1 pt. 6,965
  2. Avatar for CureCoin 22. CureCoin 1 pt. 6,907
  1. Avatar for pmdpmd 31. pmdpmd Lv 1 47 pts. 8,290
  2. Avatar for sheerbliss 32. sheerbliss Lv 1 46 pts. 8,290
  3. Avatar for nemo7731 33. nemo7731 Lv 1 45 pts. 8,287
  4. Avatar for viosca 34. viosca Lv 1 43 pts. 8,277
  5. Avatar for bertro 35. bertro Lv 1 42 pts. 8,274
  6. Avatar for smilingone 36. smilingone Lv 1 41 pts. 8,272
  7. Avatar for dcrwheeler 37. dcrwheeler Lv 1 40 pts. 8,262
  8. Avatar for martin.szew 38. martin.szew Lv 1 39 pts. 8,256
  9. Avatar for goastano 39. goastano Lv 1 38 pts. 8,255
  10. Avatar for actiasluna 40. actiasluna Lv 1 37 pts. 8,241

Comments