Placeholder image of a protein
Icon representing a puzzle

1122: Revisiting Puzzle 85: Cell Adhesion Protein

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
August 03, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein that mediates interactions between other proteins in human development. This protein contains several cysteine residues, but we'd like to model them in a reducing environment, so they should NOT form disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC

Top groups

  1. Avatar for DSN @ Home 21. DSN @ Home 1 pt. 6,965
  2. Avatar for CureCoin 22. CureCoin 1 pt. 6,907
  1. Avatar for reefyrob 41. reefyrob Lv 1 36 pts. 8,237
  2. Avatar for greepski 42. greepski Lv 1 35 pts. 8,237
  3. Avatar for pizpot 43. pizpot Lv 1 34 pts. 8,224
  4. Avatar for Crossed Sticks 44. Crossed Sticks Lv 1 33 pts. 8,223
  5. Avatar for crpainter 45. crpainter Lv 1 32 pts. 8,217
  6. Avatar for Sissue 46. Sissue Lv 1 31 pts. 8,211
  7. Avatar for sharondipity 47. sharondipity Lv 1 30 pts. 8,208
  8. Avatar for johngran 48. johngran Lv 1 29 pts. 8,206
  9. Avatar for steveB 49. steveB Lv 1 28 pts. 8,204
  10. Avatar for fishercat 50. fishercat Lv 1 27 pts. 8,198

Comments