Placeholder image of a protein
Icon representing a puzzle

1122: Revisiting Puzzle 85: Cell Adhesion Protein

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
August 03, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein that mediates interactions between other proteins in human development. This protein contains several cysteine residues, but we'd like to model them in a reducing environment, so they should NOT form disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC

Top groups

  1. Avatar for DSN @ Home 21. DSN @ Home 1 pt. 6,965
  2. Avatar for CureCoin 22. CureCoin 1 pt. 6,907
  1. Avatar for gurch 81. gurch Lv 1 10 pts. 8,002
  2. Avatar for Simek 82. Simek Lv 1 10 pts. 7,991
  3. Avatar for silverberg 83. silverberg Lv 1 9 pts. 7,990
  4. Avatar for ecali 84. ecali Lv 1 9 pts. 7,978
  5. Avatar for NR22 85. NR22 Lv 1 9 pts. 7,974
  6. Avatar for phi16 86. phi16 Lv 1 8 pts. 7,970
  7. Avatar for abiogenesis 87. abiogenesis Lv 1 8 pts. 7,964
  8. Avatar for kitek314_pl 88. kitek314_pl Lv 1 8 pts. 7,960
  9. Avatar for jermainiac 89. jermainiac Lv 1 7 pts. 7,956
  10. Avatar for shettler 90. shettler Lv 1 7 pts. 7,947

Comments