Placeholder image of a protein
Icon representing a puzzle

1122: Revisiting Puzzle 85: Cell Adhesion Protein

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
August 03, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein that mediates interactions between other proteins in human development. This protein contains several cysteine residues, but we'd like to model them in a reducing environment, so they should NOT form disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC

Top groups


  1. Avatar for Go Science 100 pts. 8,541
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 79 pts. 8,481
  3. Avatar for Beta Folders 3. Beta Folders 61 pts. 8,479
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 47 pts. 8,444
  5. Avatar for Void Crushers 5. Void Crushers 35 pts. 8,439
  6. Avatar for Gargleblasters 6. Gargleblasters 26 pts. 8,432
  7. Avatar for Contenders 7. Contenders 19 pts. 8,400
  8. Avatar for Deleted group 8. Deleted group pts. 8,292
  9. Avatar for xkcd 9. xkcd 10 pts. 8,146
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 7 pts. 8,107

  1. Avatar for alcor29 31. alcor29 Lv 1 1 pt. 8,360
  2. Avatar for Museka 32. Museka Lv 1 1 pt. 8,360
  3. Avatar for phi16 33. phi16 Lv 1 1 pt. 8,359
  4. Avatar for andrewxc 34. andrewxc Lv 1 1 pt. 8,358
  5. Avatar for goastano 35. goastano Lv 1 1 pt. 8,357
  6. Avatar for dbuske 36. dbuske Lv 1 1 pt. 8,322
  7. Avatar for ponderosa 37. ponderosa Lv 1 1 pt. 8,223
  8. Avatar for Sissue 39. Sissue Lv 1 1 pt. 8,194
  9. Avatar for O Seki To 40. O Seki To Lv 1 1 pt. 8,038

Comments