Placeholder image of a protein
Icon representing a puzzle

1122: Revisiting Puzzle 85: Cell Adhesion Protein

Closed since over 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
August 03, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein that mediates interactions between other proteins in human development. This protein contains several cysteine residues, but we'd like to model them in a reducing environment, so they should NOT form disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC

Top groups


  1. Avatar for Go Science 100 pts. 8,541
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 79 pts. 8,481
  3. Avatar for Beta Folders 3. Beta Folders 61 pts. 8,479
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 47 pts. 8,444
  5. Avatar for Void Crushers 5. Void Crushers 35 pts. 8,439
  6. Avatar for Gargleblasters 6. Gargleblasters 26 pts. 8,432
  7. Avatar for Contenders 7. Contenders 19 pts. 8,400
  8. Avatar for Deleted group 8. Deleted group pts. 8,292
  9. Avatar for xkcd 9. xkcd 10 pts. 8,146
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 7 pts. 8,107

  1. Avatar for Darkchild 191. Darkchild Lv 1 1 pt. 6,874
  2. Avatar for redyoshi49q 192. redyoshi49q Lv 1 1 pt. 6,868
  3. Avatar for brgreening 193. brgreening Lv 1 1 pt. 6,861
  4. Avatar for Gaming_Reaper 194. Gaming_Reaper Lv 1 1 pt. 6,845
  5. Avatar for Mike Cassidy 195. Mike Cassidy Lv 1 1 pt. 6,841
  6. Avatar for James.Ringler 196. James.Ringler Lv 1 1 pt. 6,840
  7. Avatar for Primus_Pilus 197. Primus_Pilus Lv 1 1 pt. 6,811
  8. Avatar for Yaddle 198. Yaddle Lv 1 1 pt. 6,789
  9. Avatar for bbmt 199. bbmt Lv 1 1 pt. 6,784
  10. Avatar for monoleuno2015 200. monoleuno2015 Lv 1 1 pt. 6,765

Comments